PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538858.1_FGP004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 731aa    MW: 82129.6 Da    PI: 6.9206
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538858.1_FGP004genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS390.12.4e-1193567271374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA+av+++d + a++lL++++++a p+gd  qRla +f+ +L+arla+++s+ly++l +++t+    s+ l+a++l+  ++P+ +
  KN538858.1_FGP004 356 LRTLLIHCAQAVAADDRRTANELLKQIRQHAKPNGDGSQRLAYCFADGLEARLAGTGSQLYHKLVAKRTT---ASDMLKAYHLYLAACPFKR 444
                        6789************************************************************999999...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        +sh++ Nq+Il  ++++++vHiiDf+i  G+QWp+L++ L +R++gpp+lRiTg++ p++g   +e++eetg+rLa++Ae++gvpfe++  +
  KN538858.1_FGP004 445 LSHFLSNQTILSLTKNASKVHIIDFGIYFGFQWPCLIRRLFKREGGPPKLRITGIDVPQPGfrPTERIEETGQRLAEYAEKIGVPFEYQG-I 535
                        ************************************************************9*****************************.7 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        a+++e++++e+L++k++E+++Vn+ ++  +l de+v+++s+r++vL+++++++P ++++   + +++ + F +rf eal ++salfd+le++
  KN538858.1_FGP004 536 ASKWETIRVEDLNIKKDEVVIVNCLYRFRNLIDETVAVDSPRNRVLNTIRQVNPAIFIHGIVNGSYSVPFFITRFREALFHFSALFDMLETT 627
                        ******************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        +pr++ +r+ +Er l+gre+ nv+aceg++r+er et+++W+ r  +aGF + pl+++++ +ak  ++ ++ + + ++e+sg+l++gWk+r 
  KN538858.1_FGP004 628 VPRDDAQRALIERDLFGREALNVIACEGSDRVERPETYKQWQVRNLRAGFVQSPLNQDIVLKAKDKVKDIYHKDFVIDEDSGWLLQGWKGRI 719
                        ***********************************************************************888****************** PP

               GRAS 367 LvsvSaWr 374
                        ++++S W+
  KN538858.1_FGP004 720 IYAISTWK 727
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.06330707IPR005202Transcription factor GRAS
PfamPF035148.3E-117356727IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MGLDNNFGEL SGMFCGLSYD GYTDHGSQSD YFRFADPQPA IVPQMDAGPS SAASSTASRA  60
AVSSGTDNPE DWEFISDESL NYISRMLMEE DIDEKVSMYQ EESAALRAAA KPFYDILGHK  120
FPPSPDHQLV AWPLDSPSES STSSYPHSLA SSVTSSSISS AVDSSQRRYV GHSEYQSLSG  180
HSSQPPVSPS SDVRNAMETL EDPLISNGRI PEYLFESFPT WDFRRGVDEA QKFLPGSDKV  240
VIDLEAGGVA KRQEAGKAIS LNGSKAEVLK VKKNRQSEDL DVMEGRNSKQ SAFCSDEPDW  300
IEMFDVLLRQ TEKKATDLRK MMRFEASKNS QVAQPKGPSG TRSRGRKPTK KDVVDLRTLL  360
IHCAQAVAAD DRRTANELLK QIRQHAKPNG DGSQRLAYCF ADGLEARLAG TGSQLYHKLV  420
AKRTTASDML KAYHLYLAAC PFKRLSHFLS NQTILSLTKN ASKVHIIDFG IYFGFQWPCL  480
IRRLFKREGG PPKLRITGID VPQPGFRPTE RIEETGQRLA EYAEKIGVPF EYQGIASKWE  540
TIRVEDLNIK KDEVVIVNCL YRFRNLIDET VAVDSPRNRV LNTIRQVNPA IFIHGIVNGS  600
YSVPFFITRF REALFHFSAL FDMLETTVPR DDAQRALIER DLFGREALNV IACEGSDRVE  660
RPETYKQWQV RNLRAGFVQS PLNQDIVLKA KDKVKDIYHK DFVIDEDSGW LLQGWKGRII  720
YAISTWKPNN N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-523607278375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0972770.0AC097277.6 Oryza sativa chromosome 3 BAC OSJNBa0022C08 genomic sequence, complete sequence.
GenBankAK1014020.0AK101402.1 Oryza sativa Japonica Group cDNA clone:J033037F15, full insert sequence.
GenBankAK1018480.0AK101848.1 Oryza sativa Japonica Group cDNA clone:J033069K04, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630944.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630943.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630942.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630941.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630940.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630939.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630938.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630937.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630936.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0GS520.0A0A0E0GS52_ORYNI; Uncharacterized protein
STRINGORGLA03G0287000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein